Recombinant CPN10 Antibody — image 1 of 2

Product details

Recombinant CPN10 Antibody

Catalog number RN-14972-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14972-01

Size / count 50 μL

Specifications

Catalog number: RN-14972-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 10 kDa heat shock protein, mitochondrial, Hsp10, 10 kDa chaperonin, Chaperonin 10, CPN10, Early-pregnancy factor, EPF
Gene Name: HSPE1
Gene ID: 3336
UniProt: P61604
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HSPE1
Target: PP-10816
Partner Proteins: 10 kDa heat shock protein; mitochondrial; Hsp10; 10 kDa chaperonin; Chaperonin 10; CPN10; Early-pregnancy factor; EPF
Clone: KBL017_4A2
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: PLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CPN10
Host or Source: Mouse
Protein Name: Heat shock protein family E (Hsp10) member 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CPN10 Antibody?

The catalog number for Recombinant CPN10 Antibody is RN-14972.

What sizes are available for Recombinant CPN10 Antibody?

Recombinant CPN10 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CPN10 Antibody come in?

Recombinant CPN10 Antibody is available in 3 different pack sizes.

Is Recombinant CPN10 Antibody in stock?

Recombinant CPN10 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.