Cystatin-A Antibody

Catalog number KC-47287-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-47287-01

Size / count 50 μL

Specifications

Catalog number: KC-47287-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cystatin-A, Cystatin-AS, Stefin-A) [Cleaved into: Cystatin-A, N-terminally processed]
Gene Name: CSTA
Gene ID: 1475
UniProt: P01040
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CSTA
Target: PP-10685
Partner Proteins: Cystatin-A; Cystatin-AS; Stefin-A) [Cleaved into: Cystatin-A; N-terminally processed]
Clone: K24095_13G11
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 63%, Rat - 59%, Pig - 75%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: PATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 63%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: STF1; STFA
Target Alternative Name: Cystatin-A
Host or Source: Mouse
Protein Name: Cystatin A
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Cystatin-A Antibody?

The catalog number for Cystatin-A Antibody is KC-47287.

What sizes are available for Cystatin-A Antibody?

Cystatin-A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Cystatin-A Antibody come in?

Cystatin-A Antibody is available in 3 different pack sizes.

Is Cystatin-A Antibody in stock?

Cystatin-A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.