Recombinant IKZF3 Antibody

Catalog number RN-14961-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14961-01

Size / count 50 μL

Specifications

Catalog number: RN-14961-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Zinc finger protein Aiolos, Ikaros family zinc finger protein 3
Gene Name: IKZF3
Gene ID: 22806
UniProt: Q9UKT9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IKZF3
Target: PP-5542
Partner Proteins: Zinc finger protein Aiolos; Ikaros family zinc finger protein 3
Clone: K92116_15B7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 86%, Rat - 46%, Pig - 92%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: KSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGSERALVLDRLASNVAKRKSSM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 86%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ZNFN1A3
Target Alternative Name: IKZF3
Panel Description: Transcription Factors
Host or Source: Mouse
Protein Name: IKAROS family zinc finger 3
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant IKZF3 Antibody?

The catalog number for Recombinant IKZF3 Antibody is RN-14961.

What sizes are available for Recombinant IKZF3 Antibody?

Recombinant IKZF3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant IKZF3 Antibody come in?

Recombinant IKZF3 Antibody is available in 3 different pack sizes.

Is Recombinant IKZF3 Antibody in stock?

Recombinant IKZF3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

All Products