Recombinant CTNNBIP1 Antibody

Catalog number RN-14832-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14832-01

Size / count 50 μL

Specifications

Catalog number: RN-14832-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Beta-catenin-interacting protein 1, Inhibitor of beta-catenin and Tcf-4
Gene Name: CTNNBIP1
Gene ID: 56998
UniProt: Q9NSA3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CTNNBIP1
Target: PP-11750
Partner Proteins: Beta-catenin-interacting protein 1; Inhibitor of beta-catenin and Tcf-4
Clone: KCA028_4B11
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 40%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Yes
IHC Dilution: 1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ICAT
Target Alternative Name: CTNNBIP1
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Catenin beta interacting protein 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CTNNBIP1 Antibody?

The catalog number for Recombinant CTNNBIP1 Antibody is RN-14832.

What sizes are available for Recombinant CTNNBIP1 Antibody?

Recombinant CTNNBIP1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CTNNBIP1 Antibody come in?

Recombinant CTNNBIP1 Antibody is available in 3 different pack sizes.

Is Recombinant CTNNBIP1 Antibody in stock?

Recombinant CTNNBIP1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.