Recombinant EPN3 Antibody

Catalog number RN-17144-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-17144-01

Size / count 50 μL

Specifications

Catalog number: RN-17144-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Epsin-3, EPS-15-interacting protein 3
Gene Name: EPN3
Gene ID: 55040
UniProt: Q9H201
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human EPN3
Target: PP-12612
Partner Proteins: Epsin-3; EPS-15-interacting protein 3
Clone: K94113_1F11
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 60%, Pig - 87%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: KERMALEGIGIGSGQLGFSRRYGEDYSRSRGSPSSYNSSSSSPRYTSDLEQARPQTSGEEELQLQLALAMSREEAEKPVPPASHRDEDLQLQLALRLSRQEHEKEVRSWQGDGSPMANGAGAVVHHQRDREPEREERKEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: EPN3
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Epsin 3
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant EPN3 Antibody?

The catalog number for Recombinant EPN3 Antibody is RN-17144.

What sizes are available for Recombinant EPN3 Antibody?

Recombinant EPN3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant EPN3 Antibody come in?

Recombinant EPN3 Antibody is available in 3 different pack sizes.

Is Recombinant EPN3 Antibody in stock?

Recombinant EPN3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products