MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody

Catalog number KC-43360-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-43360-01

Size / count 50 μL

Specifications

Catalog number: KC-43360-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associated protein 1 light chain 3 beta
Gene Name: MAP1LC3B
Gene ID: 81631
UniProt: Q9GZQ8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MAP1LC3B
Target: PP-6962
Partner Proteins: Microtubule-associated proteins 1A/1B light chain 3B; Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; MAP1 light chain 3-like protein 2; MAP1A/MAP1B light chain 3 B; MAP1A/MAP1B LC3 B; Microtubule-associated protein 1 light chain 3 beta
Clone: K40112_7F2
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: RLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MAP1ALC3
Target Alternative Name: Recognizing MAP1LC3A, MAP1LC3B and MAP1LC3B2 but not MAP1LC3C with an epitope within the region between aa31 to aa125 of MAP1LC3B
Host or Source: Mouse
Protein Name: Microtubule associated protein 1 light chain 3 beta
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody?

The catalog number for MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody is KC-43360.

What sizes are available for MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody?

MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody come in?

MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody is available in 3 different pack sizes.

Is MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody in stock?

MAP1LC3A/MAP1LC3B/MAP1LC3B2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.