Recombinant PET117 Antibody

Catalog number RN-14825-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14825-01

Size / count 50 μL

Specifications

Catalog number: RN-14825-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein PET117 homolog, mitochondrial
Gene Name: PET117
Gene ID: 100303755
UniProt: Q6UWS5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PET117
Target: PP-11681
Partner Proteins: Protein PET117 homolog; mitochondrial
Clone: K94103_8E7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Pig - 85%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: VHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAEREKMLLAKGSQKS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: PET117
Host or Source: Mouse
Protein Name: PET117 cytochrome c oxidase chaperone
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PET117 Antibody?

The catalog number for Recombinant PET117 Antibody is RN-14825.

What sizes are available for Recombinant PET117 Antibody?

Recombinant PET117 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PET117 Antibody come in?

Recombinant PET117 Antibody is available in 3 different pack sizes.

Is Recombinant PET117 Antibody in stock?

Recombinant PET117 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.