GLI2 Antibody (Biotin)

Catalog number KB-8161-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-8161-01

Size / count 50 μL

Specifications

Catalog number: KB-8161-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Zinc finger protein GLI2, GLI family zinc finger protein 2, Tax helper protein
Gene Name: GLI2
Gene ID: 2736
UniProt: P10070
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GLI2
Target: PP-738
Partner Proteins: Zinc finger protein GLI2; GLI family zinc finger protein 2; Tax helper protein
Clone: K52036_10E6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 78%, Pig - 80%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: EKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHAPLPIDMRHQEGRYHYEPHSVHGVHGPPALS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 78%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: THP
Target Alternative Name: GLI2
Panel Description: Transcription Factors
Host or Source: Mouse
Protein Name: GLI family zinc finger 2
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for GLI2 Antibody (Biotin)?

The catalog number for GLI2 Antibody (Biotin) is KB-8161.

What sizes are available for GLI2 Antibody (Biotin)?

GLI2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does GLI2 Antibody (Biotin) come in?

GLI2 Antibody (Biotin) is available in 3 different pack sizes.

Is GLI2 Antibody (Biotin) in stock?

GLI2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.