S100 alpha6 Antibody

Catalog number KC-46664-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-46664-01

Size / count 50 μL

Specifications

Catalog number: KC-46664-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein S100-A6, Calcyclin, Growth factor-inducible protein 2A9, MLN 4, Prolactin receptor-associated protein, PRA, S100 calcium-binding protein A6
Gene Name: S100A6
Gene ID: 6277
UniProt: P06703
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human S100A6
Target: PP-12527
Partner Proteins: Protein S100-A6; Calcyclin; Growth factor-inducible protein 2A9; MLN 4; Prolactin receptor-associated protein; PRA; S100 calcium-binding protein A6
Clone: K9N071_12A12
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 96%, Pig - 89%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CACY
Target Alternative Name: S100 alpha6
Host or Source: Mouse
Protein Name: S100 calcium binding protein A6
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for S100 alpha6 Antibody?

The catalog number for S100 alpha6 Antibody is KC-46664.

What sizes are available for S100 alpha6 Antibody?

S100 alpha6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does S100 alpha6 Antibody come in?

S100 alpha6 Antibody is available in 3 different pack sizes.

Is S100 alpha6 Antibody in stock?

S100 alpha6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

All Products