PALM2AKAP2 Antibody (Biotin)

Catalog number KB-36613-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-36613-01

Size / count 50 μL

Specifications

Catalog number: KB-36613-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: PALM2-AKAP2 fusion protein, A-kinase anchor protein 2, AKAP-2, AKAP-KL, Paralemmin A kinase anchor protein, Paralemmin-2, Protein kinase A-anchoring protein 2, PRKA2
Gene Name: PALM2AKAP2
Gene ID: 445815
UniProt: Q9Y2D5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human AKAP2, Recombinant human PALM2AKAP2
Target: PP-8452
Partner Proteins: PALM2-AKAP2 fusion protein; A-kinase anchor protein 2; AKAP-2; AKAP-KL; Paralemmin A kinase anchor protein; Paralemmin-2; Protein kinase A-anchoring protein 2; PRKA2
Clone: K8U062_13F6
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 91%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: TTLKKEAKFELRAFHEDKKPSKLFEDDEHEKEQYCIRKVRPSEEMLELEKERRELIRSQAVKKNPGIAAKWWNPPQEKTIEEQLDEEHLESHKKYKERKERRAQQEQLLLQKQLQQQQQQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0920; PAKAP; PALM2
Target Alternative Name: PALM2AKAP2
Host or Source: Mouse
Protein Name: PALM2 and AKAP2 fusion
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for PALM2AKAP2 Antibody (Biotin)?

The catalog number for PALM2AKAP2 Antibody (Biotin) is KB-36613.

What sizes are available for PALM2AKAP2 Antibody (Biotin)?

PALM2AKAP2 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PALM2AKAP2 Antibody (Biotin) come in?

PALM2AKAP2 Antibody (Biotin) is available in 3 different pack sizes.

Is PALM2AKAP2 Antibody (Biotin) in stock?

PALM2AKAP2 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

All Products