TP53TG5 Antibody (Biotin)

Catalog number KB-33617-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-33617-01

Size / count 50 μL

Specifications

Catalog number: KB-33617-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: TP53-target gene 5 protein, TP53-inducible gene 5 protein
Gene Name: TP53TG5
Gene ID: 27296
UniProt: Q9Y2B4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TP53TG5
Target: PP-5986
Partner Proteins: TP53-target gene 5 protein; TP53-inducible gene 5 protein
Clone: K40104_1G2
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Pig - 42%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: NKTKQNNEEFQEIGCSEKELKSKKLESTGDPKKKEYKEWKSQVQSGMRNKEKTSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRNRTPMGHMKQLDVADQWIW
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: C20orf10
Target Alternative Name: TP53TG5
Host or Source: Mouse
Protein Name: TP53 target 5
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for TP53TG5 Antibody (Biotin)?

The catalog number for TP53TG5 Antibody (Biotin) is KB-33617.

What sizes are available for TP53TG5 Antibody (Biotin)?

TP53TG5 Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does TP53TG5 Antibody (Biotin) come in?

TP53TG5 Antibody (Biotin) is available in 3 different pack sizes.

Is TP53TG5 Antibody (Biotin) in stock?

TP53TG5 Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.