CORO1C Antibody (Biotin)

Catalog number KB-31641-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KB-31641-01

Size / count 50 μL

Specifications

Catalog number: KB-31641-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Coronin-1C, Coronin-3, hCRNN4
Gene Name: CORO1C
Gene ID: 23603
UniProt: Q9ULV4
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CORO1C
Target: PP-4578
Partner Proteins: Coronin-1C; Coronin-3; hCRNN4
Clone: K9N043_16F1
Conjugation: Conjugated with biotin
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 50%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: PRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 92%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: CRN2; CRNN4
Target Alternative Name: CORO1C
Host or Source: Mouse
Protein Name: Coronin 1C
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CORO1C Antibody (Biotin)?

The catalog number for CORO1C Antibody (Biotin) is KB-31641.

What sizes are available for CORO1C Antibody (Biotin)?

CORO1C Antibody (Biotin) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CORO1C Antibody (Biotin) come in?

CORO1C Antibody (Biotin) is available in 3 different pack sizes.

Is CORO1C Antibody (Biotin) in stock?

CORO1C Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

All Products