Recombinant RPRD1B Antibody

Catalog number RN-17172-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-17172-01

Size / count 50 μL

Specifications

Catalog number: RN-17172-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Regulation of nuclear pre-mRNA domain-containing protein 1B, Cell cycle-related and expression-elevated protein in tumor
Gene Name: RPRD1B
Gene ID: 58490
UniProt: Q9NQG5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RPRD1B
Target: PP-2812
Partner Proteins: Regulation of nuclear pre-mRNA domain-containing protein 1B; Cell cycle-related and expression-elevated protein in tumor
Clone: K24102_15F2
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSLLPNVT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C20orf77; CREPT
Target Alternative Name: RPRD1B
Host or Source: Mouse
Protein Name: Regulation of nuclear pre-mRNA domain containing 1B
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant RPRD1B Antibody?

The catalog number for Recombinant RPRD1B Antibody is RN-17172.

What sizes are available for Recombinant RPRD1B Antibody?

Recombinant RPRD1B Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant RPRD1B Antibody come in?

Recombinant RPRD1B Antibody is available in 3 different pack sizes.

Is Recombinant RPRD1B Antibody in stock?

Recombinant RPRD1B Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

All Products