Recombinant BEX5 Antibody

Catalog number RN-14926-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14926-01

Size / count 50 μL

Specifications

Catalog number: RN-14926-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein BEX5, Brain-expressed X-linked protein 5, NGFRAP1-like protein 1, Nerve growth factor receptor-associated protein 2
Gene Name: BEX5
Gene ID: 340542
UniProt: Q5H9J7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BEX5
Target: PP-7779
Partner Proteins: Protein BEX5; Brain-expressed X-linked protein 5; NGFRAP1-like protein 1; Nerve growth factor receptor-associated protein 2
Clone: KBL018_11B5
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 50%, Rat - 62%, Pig - 78%, Cynomolgus monkey - 85%
Purity: ≥85%
Cores: VEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDGDDMERFMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 50%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NADE2; NGFRAP1L1
Target Alternative Name: BEX5
Host or Source: Mouse
Protein Name: Brain expressed X-linked 5
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant BEX5 Antibody?

The catalog number for Recombinant BEX5 Antibody is RN-14926.

What sizes are available for Recombinant BEX5 Antibody?

Recombinant BEX5 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant BEX5 Antibody come in?

Recombinant BEX5 Antibody is available in 3 different pack sizes.

Is Recombinant BEX5 Antibody in stock?

Recombinant BEX5 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

All Products