IL 1 beta Human, HEK

Catalog number OM296786-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for OM296786-01

Size / count 2 µg

About this product

Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation.

Specifications

Catalog number: OM296786-01
Size / count: 2 µg
Dry ice: No
Hazardous: No
Discontinued: No
Swiss Prot: P01584
Source: HEK.
Buffer: The IL-1 beta was lyophilized from 1 mg/mL in 1xPBS.
Storage Conditions: Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP

Frequently Asked Questions

What is the catalog number for IL 1 beta Human, HEK?

The catalog number for IL 1 beta Human, HEK is OM296786.

What sizes are available for IL 1 beta Human, HEK?

IL 1 beta Human, HEK is available in the following size(s): 2 µg, 10 µg, 1 mg.

How many pack sizes does IL 1 beta Human, HEK come in?

IL 1 beta Human, HEK is available in 3 different pack sizes.

Is IL 1 beta Human, HEK in stock?

IL 1 beta Human, HEK is currently made to order / not held in immediate stock. Contact us for lead time.

What is IL 1 beta Human, HEK used for?

Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.