BMP 7 Human, Plant

Catalog number OM296898-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for OM296898-01

Size / count 10 µg

About this product

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.

Specifications

Catalog number: OM296898-01
Size / count: 10 µg
Dry ice: No
Hazardous: No
Discontinued: No
Swiss Prot: P18075
Source: Nicotiana benthamiana.
Buffer: BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Storage Conditions: Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities: HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN

Frequently Asked Questions

What is the catalog number for BMP 7 Human, Plant?

The catalog number for BMP 7 Human, Plant is OM296898.

What sizes are available for BMP 7 Human, Plant?

BMP 7 Human, Plant is available in the following size(s): 10 µg, 2 µg, 1 mg.

How many pack sizes does BMP 7 Human, Plant come in?

BMP 7 Human, Plant is available in 3 different pack sizes.

Is BMP 7 Human, Plant in stock?

BMP 7 Human, Plant is currently made to order / not held in immediate stock. Contact us for lead time.

What is BMP 7 Human, Plant used for?

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.