SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag

Catalog number RCOV03

Price for RCOV03

Size / count 100 µg/Vial

About this product

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact support@bosterbio.com.

Specifications

Catalog number: RCOV03
Size / count: 100 µg/Vial
Dry ice: No
Hazardous: No
Discontinued: No
Synonyms: SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP9, Nonstructural Protein 9
Reactivity: Mouse
Source: E. coli
Endotoxin: Less than 1 EU/μg protein as determined by LAL method.
Form: Lyophilized
Storage Conditions: The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Calculated Molecular Weight: 13.2KD
AA Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Contents: Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose

Frequently Asked Questions

What is the catalog number for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag?

The catalog number for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is RCOV03.

What sizes are available for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag?

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is available in the following size(s): 100 µg/Vial.

Is SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag in stock?

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is currently made to order / not held in immediate stock. Contact us for lead time.

Where can I find the safety data sheet (SDS/MSDS) for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag?

The safety data sheet for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is available here: https://www.bosterbio.com/msds?sku=RCOV03.

What is SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag used for?

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

All Products