Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Catalog number PROTP05017-2-500ug

Price for PROTP05017-2-500ug

Size / count 500 µg

About this product

Insulin Like Growth Factors 1 (IGF-I) is a 7.81 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, cervi, endometrial stromal cells, leydig cells, and can be isolated from plasma. IGF-I is mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.

Specifications

Catalog number: PROTP05017-2-500ug
Size / count: 500 µg
Dry ice: No
Hazardous: No
Discontinued: No
Synonyms: Somatamedin C, IGF-IA
Gene Name: IGF1
UniProt: P05017
Reactivity: Mouse
Tag: His Tag (C-term)
Source: Escherichia coli
Applications: Cell Culture
Purification: >98% as determined by SDS-PAGE.
Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
Bioactivity: Measure by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is <2 ng/mL. The specific activity of recombinant mouse IGF-I is > 5 x 105 IU/mg.
Form: The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Reconstitution: Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Molecular Weight: The protein has a calculated MW of 8.61 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis) .
Storage Conditions: Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
AA Sequence: MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA with polyhistidine tag at the C-terminus.

Frequently Asked Questions

What is the catalog number for Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF?

The catalog number for Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF is PROTP05017-2-500ug.

What sizes are available for Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF?

Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF is available in the following size(s): 500 µg.

Is Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF in stock?

Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF is currently made to order / not held in immediate stock. Contact us for lead time.

What is Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF used for?

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.