Bcl-2 Antibody (Middle Region)

Catalog number R32814

Discontinued

Price for R32814

Size / count 100 µg

This variant is discontinued and cannot be added to your cart.

About this product

Immunoreactive BCL2 protein is in the neoplastic cells of almost all follicular lymphomas whereas no BCL2 protein was detected in follicles affected by nonneoplastic processes or in normal lymphoid tissue. Every tumor with molecular-genetic evidence of t(14;18) translocation expressed detectable levels of BCL2 protein, regardless of whether the breakpoint was located in or at a distance from the BCL2 gene. Overexpression of BCL2 blocks the apoptotic death of a pro-B-lymphocyte cell line.

Specifications

Catalog number: R32814
Size / count: 100 µg
Dry ice: No
Hazardous: No
Discontinued: Yes
CAS Number: 9007-83-4
UniProt: P10415
Host: Rabbit
Immunogen: Amino acids 102-140 (DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD) were used as the immunogen for the Bcl-2 antibody.
Clonality: Polyclonal
Isotype: IgG
Applications: WB, IHC-P, FACS
Format: Antigen affinity purified
Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Reconstitution: After reconstitution, the Bcl-2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitations: This Bcl-2 antibody is available for research use only.

Frequently Asked Questions

What is the catalog number for Bcl-2 Antibody (Middle Region)?

The catalog number for Bcl-2 Antibody (Middle Region) is R32814.

Is Bcl-2 Antibody (Middle Region) in stock?

Bcl-2 Antibody (Middle Region) is currently made to order / not held in immediate stock. Contact us for lead time.

What is Bcl-2 Antibody (Middle Region) used for?

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

All Products