DOG-1 (DOG1.1), 1mg/mL

Catalog number BNUM0725-50

Price for BNUM0725-50

Size / count 1x 50 µL

About this product

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.Primary antibodies are available purified, or with a selection of fluorescent CF® Dyes and other labels. CF® Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.

Specifications

Catalog number: BNUM0725-50
Size / count: 1x 50 µL
Dry ice: No
Hazardous: No
Discontinued: No
CAS Number: 9007-83-4
Synonyms: Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A
UNSPSC: 41116161
UNSPSC Description: Primary and secondary antibodies for multiple methodology immunostaining detection application
Gene Name: TMEM16A
Gene ID: 55107
NCBI Gene ID: 503074
UniProt: Q5XXA6
Swiss Prot: Q5XXA6
Host: Mouse
Species Reactivity: Human
Reactivity: DOG-1|TMEM16A
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Target Antigen: DOG-1 | TMEM16A
Clonality: Monoclonal
Clone: DOG1.1
Type: Primary
Source: Animal
Origin: Animal
Applications: IHC, FFPE (verified)
Field of Research: Cancer
Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Stability: 2 years
Concentration: 1 mg/mL
Buffer: PBS, no BSA, no azide
Molecular Weight: ~114 kDa
Shipping Conditions: RT (ND)
Storage Conditions: Stable at room temperature or 37°C (98°F) for 7 days.
Shelf Life: Guaranteed for at least 24 months from date of receipt when stored as recommended
Fragment: IgG1, kappa
Species: Mus musculus (mouse)
Classification: PBS, no BSA, no sodium azide (CAS 26628-22-8)
Conjugate: Purified, BSA-free

Frequently Asked Questions

What is the catalog number for DOG-1 (DOG1.1), 1mg/mL?

The catalog number for DOG-1 (DOG1.1), 1mg/mL is BNUM0725-50.

What sizes are available for DOG-1 (DOG1.1), 1mg/mL?

DOG-1 (DOG1.1), 1mg/mL is available in the following size(s): 1x 50 µL.

Is DOG-1 (DOG1.1), 1mg/mL in stock?

DOG-1 (DOG1.1), 1mg/mL is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures DOG-1 (DOG1.1), 1mg/mL?

DOG-1 (DOG1.1), 1mg/mL is manufactured by Biotium.

What is the estimated delivery time for DOG-1 (DOG1.1), 1mg/mL?

Estimated delivery time for DOG-1 (DOG1.1), 1mg/mL is approximately 15 business day(s), depending on your location.

Where can I find the safety data sheet (SDS/MSDS) for DOG-1 (DOG1.1), 1mg/mL?

The safety data sheet for DOG-1 (DOG1.1), 1mg/mL is available here: https://biotium.com/wp-content/uploads/2018/06/SDS-primary-antibodies.pdf.

What is DOG-1 (DOG1.1), 1mg/mL used for?

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.