DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL

Catalog number BNCB0725-500

Price for BNCB0725-500

Size / count 1x 500 µL

About this product

Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.Primary antibodies are available purified, or with a selection of fluorescent CF® Dyes and other labels. CF® Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF®405S and CF®405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.

Specifications

Catalog number: BNCB0725-500
Size / count: 1x 500 µL
Dry ice: No
Hazardous: No
Discontinued: No
CAS Number: 9007-83-4
Synonyms: Anoctamin 1; Calcium Activated Chloride Channel; Discovered On Gastrointestinal Stromal Tumors Protein 1; TAOS2; ORAOV2; TMEM16A
UNSPSC: 41116161
UNSPSC Description: Primary and secondary antibodies for multiple methodology immunostaining detection application
Gene Name: TMEM16A
Gene ID: 55107
NCBI Gene ID: 503074
UniProt: Q5XXA6
Swiss Prot: Q5XXA6
Host: Mouse
Species Reactivity: Human
Reactivity: DOG-1|TMEM16A
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Target Antigen: DOG-1 | TMEM16A
Clonality: Monoclonal
Clone: DOG1.1
Type: Primary
Source: Animal
Origin: Animal
Applications: IHC, FFPE (verified)
Field of Research: Cancer
Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Stability: 2 years
Concentration: 0.1 mg/mL
Buffer: PBS, 0.1% BSA, 0.05% azide
Molecular Weight: ~114 kDa
Shipping Conditions: RT (ND)
Storage Conditions: Stable at room temperature or 37°C (98°F) for 7 days.
Shelf Life: Guaranteed for at least 24 months from date of receipt when stored as recommended
Fragment: IgG1, kappa
Species: Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.
Classification: 0.05% sodium azide (CAS 26628-22-8)
Conjugate: Biotin

Frequently Asked Questions

What is the catalog number for DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL?

The catalog number for DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL is BNCB0725-500.

What sizes are available for DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL?

DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL is available in the following size(s): 1x 500 µL.

Is DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL in stock?

DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL?

DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL is manufactured by Biotium.

What is the estimated delivery time for DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL?

Estimated delivery time for DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL is approximately 15 business day(s), depending on your location.

Where can I find the safety data sheet (SDS/MSDS) for DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL?

The safety data sheet for DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL is available here: https://biotium.com/wp-content/uploads/2018/06/SDS-primary-antibodies.pdf.

What is DOG-1 (DOG1.1), Biotin conjugate, 0.1mg/mL used for?

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.